RTL oder Pro Sieben in HD empfangen, aber ohne einen weiteren Receiver an meinen Fernseher anzuschließen. var ctaHTML = '. count = 0; LITHIUM.CustomEvent('.lia-custom-event', 'click'); "useSubjectIcons" : "true", "}); }, "action" : "rerender" } "eventActions" : [ } $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); }, "actions" : [ "event" : "MessagesWidgetEditAnswerForm", { $('#vodafone-community-header .lia-search-toggle').click(function() { "context" : "envParam:quiltName,message", Scan websites for malware, exploits and other infections with quttera detection engine to check if the site is safe to browse. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "", "action" : "rerender" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_862365dcc14513_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/123456/thread-id/223576&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); "componentId" : "kudos.widget.button", "event" : "ProductAnswer", .attr('aria-hidden','false') "message" : "2497943", //} else { $(this).next().toggle(); }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2497394 .lia-rating-control-passive', '#form'); { "action" : "rerender" }, "action" : "rerender" "context" : "", "actions" : [ "event" : "MessagesWidgetEditAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); { }, { "context" : "", ] ;(function($) { }, // just for convenience, you need a login anyways... LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); { "event" : "unapproveMessage", ] }, } }; "initiatorBinding" : true, "event" : "MessagesWidgetEditAnswerForm", }, event.stopPropagation(); } ] } var element = $(this).parent('li'); ;(function($) { "initiatorBinding" : true, { "context" : "envParam:quiltName,product,contextId,contextUrl", { "event" : "removeMessageUserEmailSubscription", "actions" : [ Je nach Kabelnetzbetreiber existieren verschiedene Sender-Einspeisungen. }); { var key = e.keyCode; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); { { "event" : "approveMessage", "context" : "envParam:entity", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497394}},{"elementId":"link_9","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497603}},{"elementId":"link_13","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497943}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2581614}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2586982}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601146}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601034}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2600873}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602407}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602311}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602222}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602220}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602149}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602061}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602042}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602012}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602007}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601861}}]); Wie Sky Ticket funktioniert, erklären wir im Video. lithstudio: [], LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetMessageEdit", count = 0; { "eventActions" : [ "action" : "rerender" }, ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { }, } ] return; "truncateBodyRetainsHtml" : "false", "context" : "", var clickedDomElement = $(this); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); } "entity" : "2497603", "event" : "kudoEntity", ] 2 Monats-Gutschein einlösen. "action" : "rerender" "showCountOnly" : "false", } }); "context" : "", ] "actions" : [ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ element.siblings('li').find('li').removeClass('active'); count = 0; resetMenu(); }, }, "event" : "approveMessage", "action" : "rerender" $(this).removeClass('active'); { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "expandMessage", ] $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); { ;(function($) { "actions" : [ "context" : "", "linkDisabled" : "false" "actions" : [ "event" : "MessagesWidgetEditAction", Der Empfang ist über Sat, IP-TV und eben auch über das Kabelnetz möglich. ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. Bist du sicher, dass du fortfahren möchtest? ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { Darüber hinaus genießt Du mit HD+ über Sky unter anderem den Sportsender Sport1 und den Disney Channel im HD-Format. if ( count == neededkeys.length ) { "action" : "rerender" } "event" : "ProductAnswerComment", "initiatorDataMatcher" : "data-lia-message-uid" } }, "context" : "", "actions" : [ ] } { } }); } } "context" : "", "event" : "kudoEntity", } "action" : "rerender" { "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", "action" : "rerender" { ', 'ajax'); "disableLinks" : "false", }); "selector" : "#messageview_1", "action" : "rerender" // console.log('watching: ' + key); } // Oops. ] }); ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] .attr('aria-expanded','false'); "action" : "rerender" "event" : "ProductAnswerComment", "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" }, "forceSearchRequestParameterForBlurbBuilder" : "false", // Set start to true only if the first key in the sequence is pressed }, "actions" : [ }, } //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} })(LITHIUM.jQuery); "actions" : [ "revokeMode" : "true", "action" : "rerender" '; { }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'ueAlmb1fYHV-UYaeHhTRhny49TI2Xs_ZVvp4zpOLETg. }, ] "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:quiltName,message", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "event" : "ProductAnswerComment", ], }); ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "dialogContentCssClass" : "lia-panel-dialog-content", { "actions" : [ "event" : "MessagesWidgetEditAnswerForm", "kudosLinksDisabled" : "false", } Kann man die HD sender auf die vorhandene Smartcard von Sky reischalten lassen? Nein, @Celine9819 ist hier schon ganz richtig. }, "context" : "", ', 'ajax'); "actions" : [ "eventActions" : [ }, { "context" : "envParam:quiltName,message,product,contextId,contextUrl", }); // We're good so far. // console.log(key); ] notifCount = parseInt($(this).html()) + notifCount; //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); // Oops. }); }, LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); { return; und die Sky Marken sind Marken von Sky International AG und werden in Lizenz genutzt. "event" : "QuickReply", ] "event" : "deleteMessage", "action" : "addClassName" $('.js-close-header-announcement').on('click', clickHandler); "event" : "deleteMessage", "initiatorDataMatcher" : "data-lia-kudos-id" "initiatorBinding" : true, "context" : "", Die Bestellung ist ganz einfach und kann direkt online abgeschlossen werden: Wähle Deine Pakete: Sky Entertainment, Sky Sport, Sky Fußball Bundesliga oder Sky Cinema sowie weitere Zusatzoptionen. { { "action" : "rerender" }, LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); })(LITHIUM.jQuery); LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'TMXQZk5viltgUyLRTopcfOHOP-XVZkEp0hkGmD81LFA. "kudosable" : "true", } { "action" : "rerender" window.location.replace('/t5/user/userloginpage'); "actions" : [ { "event" : "MessagesWidgetMessageEdit", "actions" : [ ] "actions" : [ } }); "closeEvent" : "LITHIUM:lightboxCloseEvent", $('#vodafone-community-header .lia-search-input-wrapper').hide(); "actions" : [ "event" : "AcceptSolutionAction", "event" : "markAsSpamWithoutRedirect", ] "dialogContentCssClass" : "lia-panel-dialog-content", "actions" : [ } ], "useSubjectIcons" : "true", $(this).addClass('active') LITHIUM.AjaxSupport.ComponentEvents.set({ ] }); ] "context" : "", ] { "action" : "rerender" "context" : "envParam:quiltName,message", "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); // --> } "componentId" : "kudos.widget.button", "actions" : [ "actions" : [ "actions" : [ LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); { "context" : "", ] "event" : "addMessageUserEmailSubscription", ] var keycodes = { "event" : "addThreadUserEmailSubscription", ] } } "useTruncatedSubject" : "true", ] "defaultAriaLabel" : "", { ] }, "context" : "", "event" : "MessagesWidgetEditAnswerForm", "message" : "2497603", if ( count == neededkeys.length ) { Sky und HD+ solltest du sich sowieso an Sky wenden. } } { { resetMenu(); "context" : "", { { "action" : "rerender" { { { { ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "QuickReply", } Über das Vodafone Kabelnetz kann die Buchung über verschiedene Wege erfolgen. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "includeRepliesModerationState" : "false", }else{ } LITHIUM.AjaxSupport.ComponentEvents.set({ } } "action" : "rerender" "disableKudosForAnonUser" : "false", }, element.siblings('li').find('ul').slideUp(); { if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "triggerEvent" : "click", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" }, $('div[class*="-menu-btn"]').removeClass('active'); { ] "event" : "deleteMessage", { }); { { "selector" : "#kudosButtonV2", { "selector" : "#kudosButtonV2_0", "context" : "", lithadmin: [] }, "buttonDialogCloseAlt" : "Schließen", Februar 2021 um 01:57 ... Sky Sport F1 HD Vodafone Basic TV: Toggo Plus HD Vodafone Basic TV: VOX up HD. { "context" : "envParam:quiltName,expandedQuiltName", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); // --> "action" : "rerender" LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); So müsstest du mit dem passenden Verstärker eigentlich 15 HD-Sender plus neun Feeds von Sky empfangen können. } else { } }); $('#node-menu li.active').children('ul').show(); } } }, } "context" : "envParam:quiltName,message,product,contextId,contextUrl", watching = true; "context" : "envParam:quiltName", { "actions" : [ "event" : "MessagesWidgetAnswerForm", ] "activecastFullscreen" : false, }, } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "event" : "removeThreadUserEmailSubscription", }, ] ... Sky HD *Über Satellit bzw. "activecastFullscreen" : false, { "action" : "rerender" "action" : "rerender" expireDate.setDate(expireDate.getDate() + 365*10); LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); Du befindest Dich auf der Webseite von Sky Deutschland. { "context" : "envParam:entity", ;(function($) { "action" : "rerender" "actions" : [ { watching = false; "disableLabelLinks" : "false", }, "action" : "pulsate" "event" : "MessagesWidgetEditCommentForm", }); ] "action" : "addClassName" Alle HD+ Sender sind für dich empfangbar, solange du über einen Satelliten-Empfang und ein Sky CI … } "event" : "QuickReply", "dialogKey" : "dialogKey" "event" : "removeMessageUserEmailSubscription", LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); $('#custom-overall-notif-count').html(notifCount); } } } { var expireDate = new Date(); ] } if ( count == neededkeys.length ) { $('.lia-button-wrapper-searchForm-action').removeClass('active'); "event" : "removeMessageUserEmailSubscription", "actions" : [ "context" : "", "event" : "unapproveMessage", if ( neededkeys[count] == key ) { "truncateBodyRetainsHtml" : "false", "context" : "", { var handleOpen = function(event) { logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "context" : "envParam:selectedMessage", resetMenu(); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_862365dcc14513_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/123456/thread-id/223576&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "unapproveMessage", "componentId" : "kudos.widget.button", { { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":464,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXD1QMC1ZaDlIAARgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUAVwpSUF0OXxRRV1ICSQEEB1ZIV1VaCk9TA1NUBgYCVQ9RAAtAThUPVn1bVgB\/AhsIQFMFVwEGAhBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "MessagesWidgetCommentForm", } "event" : "AcceptSolutionAction", "}); }, Soweit ich weiß gibt es noch keine Auslieferung der Giga Box bei Vodafone West, du erhältst weiterhin die Horizon Box oder CI Modul. { $(this).next().toggle(); "quiltName" : "ForumMessage", "actions" : [ { "action" : "rerender" { } "context" : "envParam:quiltName,product,contextId,contextUrl", watching = false; "useTruncatedSubject" : "true", }, "actions" : [ } "event" : "MessagesWidgetMessageEdit", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); "action" : "rerender" Neue Sky HD-Sender für Kabel-Kunden. "kudosLinksDisabled" : "false", } "context" : "", }, count = 0; resetMenu(); } LITHIUM.AjaxSupport.ComponentEvents.set({ }, "}); } "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ { } $('div[class*="-menu-btn"]').removeClass('active'); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ }, if (element.hasClass('active')) { "action" : "rerender" ], Außerdem benötigst Du eine Smartcard und einen Digital-Receiver, um die Sender von Sky zu entschlüsseln. "context" : "lia-deleted-state", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { "event" : "MessagesWidgetMessageEdit", 113 Sender, davon 41 in HD & 43 in Full-HD - ab dem dritten Monat 13,99 € pro Monat*, monatlich kündbar. "event" : "MessagesWidgetCommentForm", Das bedeutet, dass der Hausanschlussverstärker Frequenzen bis 862 MHz verstärkt und auch die verlegten Kabel die Frequenzen weiterleiten. document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); "context" : "envParam:quiltName,expandedQuiltName", ] } }; LITHIUM.Auth.CHECK_SESSION_TOKEN = 'wTc57VkwDtr_91quRiUh7fkvw5SNp2qkQeU548MGgCY. }); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2497394,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "actions" : [ } { LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:quiltName", if ( !watching ) { $(document).ready(function() { "truncateBody" : "true", "event" : "RevokeSolutionAction", "actions" : [ "action" : "pulsate" "context" : "", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2497943 .lia-rating-control-passive', '#form_1'); })(LITHIUM.jQuery); .attr('aria-expanded','true') "context" : "", })(LITHIUM.jQuery); } }, } else { } } ] $(this).toggleClass("view-btn-open view-btn-close"); "actions" : [ } { ] ] } "context" : "", "kudosable" : "true", "context" : "", "actions" : [ "event" : "QuickReply", } "context" : "", { { // We're good so far. } "event" : "approveMessage",